LL-37: Evidence, Mechanism, Dosing & Legal Status
A clinical monograph on LL-37 — the only human cathelicidin antimicrobial peptide. Small topical wound-healing RCTs (grade B), strong preclinical mechanism, and a sharply double-edged immune profile.
LL-37 is the only cathelicidin host-defense peptide in humans, with an elegant, well-mapped mechanism but a narrow human evidence base. Its only human controlled evidence is small topical wound-healing RCTs in venous leg ulcers, graded B; its antimicrobial, anti-biofilm, angiogenic and immune actions remain preclinical (C) or anecdotal (D). It is not FDA-approved, sits in a shifting 2026 regulatory gray zone, and carries serious theoretical autoimmune and tumor-promotion concerns.17
LL-37 is the only member of the cathelicidin antimicrobial-peptide family found in humans — a 37-residue, cationic, amphipathic alpha-helical fragment cleaved from the precursor hCAP-18 and central to innate host defense.11 It is best understood as a multifunctional immune molecule rather than a "performance" peptide, and its growing popularity in wellness circles runs well ahead of its human proof. This monograph separates the two.
This article is informational and editorial content for research and educational purposes only. It is not medical advice, not a protocol to follow, and not a sourcing guide. LL-37 is not an FDA-approved drug; it is sold as a "research chemical not for human use" and remains effectively FDA-restricted through 2026. Dosing figures are reported strictly as seen in the published literature for completeness — not as recommendations. Consult a licensed clinician before any health decision.
What is LL-37 and how does it work?
LL-37 is encoded by the CAMP gene on chromosome 3p21.31, translated as the 18-kDa precursor hCAP-18, and named for its two N-terminal leucines plus 37 total residues (sequence [LL-37, 37 aa], about 4.5 kDa, net charge near +6 at physiological pH).124 The mature peptide is liberated from hCAP-18 by proteinase 3 in neutrophils and by kallikreins in skin, and it is also produced by macrophages, mast cells, NK cells and epithelial cells of skin, gut and airway.11
Its antimicrobial mechanism is physical membrane disruption. As a cationic amphipath, LL-37 binds preferentially to anionic microbial membranes by electrostatic attraction, then inserts into the hydrophobic lipid core and destabilizes the bilayer — killing Gram-positive and Gram-negative bacteria, fungi and some enveloped viruses at effective concentrations from roughly 1 micromolar.4 Its disruption mode actually switches with membrane lipid structure, forming pores in unsaturated bilayers versus helical fibrous nanofibre superstructures in saturated ones, and it is documented against S. aureus (including MRSA), E. coli and other pathogens while inhibiting biofilm formation.46
Beyond killing, LL-37 is a potent immune modulator with a genuinely double-edged profile. On the protective side it neutralizes LPS (endotoxin) by direct binding, is protective in septic animal models, and can inhibit LPS/ATP-induced macrophage pyroptosis.8 On the harmful side, when complexed with self-DNA or self-RNA from dying cells it converts host nucleic acid into a potent stimulus that activates plasmacytoid dendritic cells via TLR9 (driving type-I interferon) and myeloid dendritic cells via TLR7/8, and it is an established T-cell autoantigen in psoriasis, with implications in lupus and atherosclerosis.7 For wound repair, LL-37 promotes neovascularization and re-epithelialization through the formyl-peptide receptor FPR2, EGFR transactivation, and a COX-1-dependent PGE2 pathway that is inhibitable by aspirin in vivo.5
One reason systemic dosing is impractical is pharmacokinetics: native LL-37 is proteolytically fragile, with a human plasma half-life of roughly 90 to 120 minutes, cleared by renal filtration and serum proteases that cleave at leucine-leucine bonds, while wound-fluid proteases rapidly inactivate it in situ.143 Oral bioavailability is effectively nil. This is why development has focused on topical delivery and engineered protease-resistant analogs.11
What is the evidence by indication?
The only human controlled evidence is in topical wound healing; everything else is animal-model or mechanistic work. The table below grades each indication honestly.
| Indication | Best evidence | Grade |
|---|---|---|
| Chronic wound healing (topical venous leg ulcers) | Small randomized, double-blind, placebo-controlled trials (n~34 phase I/IIa; larger phase II) | B (human RCT, small) |
| Antimicrobial / anti-biofilm (infected wounds) | MRSA-infected mouse wound model; in-vitro biofilm activity | C (preclinical) |
| Angiogenesis / tissue repair | FPR2/COX-1-PGE2 endothelial work; CRAMP-knockout mice; rabbit ischemia model | C (preclinical) |
| Immune modulation / antiviral / sepsis-LPS | LPS neutralization, anti-pyroptotic and antiviral binding in cell/animal systems | C (preclinical) |
| Gut / "leaky gut" / general immune claims | Mucosal-immunity biology only; no controlled human trial of exogenous LL-37 | D (anecdotal) |
The wound-healing data are the headline. In a first-in-man phase I/IIa randomized, double-blind, placebo-controlled trial, 34 patients with hard-to-heal venous leg ulcers received topical synthetic LL-37 at 0.5, 1.6 or 3.2 mg/mL twice weekly for four weeks after a placebo run-in. The healing-rate constants were roughly six-fold higher at 0.5 mg/mL (p=0.003) and three-fold higher at 1.6 mg/mL versus placebo, with mean ulcer-area reductions near 68% and 50% — but the highest dose (3.2 mg/mL) showed no benefit and more local reactions, an inverted dose-response consistent with LL-37's cytotoxicity at higher concentrations.1 A subsequent larger multicentric phase II trial reported improved healing in larger wounds with negative prognostic factors.2 Readers can confirm the registered trial record and outcomes through indexed databases such as PubMed.
The preclinical signals are mechanistically strong but unproven in humans. In an MRSA-infected full-thickness wound model in 80 mice, combined topical and intraperitoneal LL-37 (1 mg/kg each) cut wound S. aureus burden from about 7.8x10^7 to 6.9x10^2 CFU/g (p<0.001) — comparable to teicoplanin — while producing superior re-epithelialization, granulation and angiogenesis.3 LL-37 also drives neovascularization via FPR2 and COX-1/PGE2, and is required for wound angiogenesis in CRAMP-knockout mice.5 Immune and antiviral effects (LPS neutralization, anti-pyroptotic action, spike-protein binding) are documented only in cell and animal systems.815 Consumer gut, "leaky gut," chronic-Lyme and general-immune claims have no controlled human support and are graded D.13
Proven in humans: a small topical wound-healing signal in venous leg ulcers, where "more is worse." Hyped: systemic antimicrobial, immune, antiviral, gut and longevity claims, which extrapolate from mechanism and mouse data. Do not read a strong mechanism as a proven human therapy.1
What doses appear in the literature?
Reported strictly as information, not a protocol. The only human-tested route is topical: synthetic LL-37 at 0.5 to 1.6 mg/mL applied to the wound bed twice weekly, as used in the venous-leg-ulcer trials; the 3.2 mg/mL concentration was less effective and more irritating, an explicit example of an inverted dose-response.1 Preclinical animal work used roughly 1 mg/kg topical and/or intraperitoneal in the MRSA model, and even consecutive daily dosing could not sustain plasma levels given the 90-to-120-minute half-life.314 No validated subcutaneous or IV human protocol exists; gray-market vendors market injectable native LL-37, but there is no FDA-sanctioned systemic dose, no pharmaceutical quality assurance, and the peptide's rapid proteolysis plus cytotoxicity and immunogenicity concerns make such use unsupported.20 A lab-handling note: native LL-37 retained about 94% potency at 4 degrees Celsius in sterile water over 28 days but lost roughly 40% activity within 72 hours at room temperature.21
The functional-medicine framing. Because the validated lever on this pathway is endogenous cathelicidin, the literature on vitamin D as a CAMP-gene inducer — via a vitamin-D response element in the gene promoter — is more relevant to most readers than exogenous LL-37, and is addressable through ordinary nutritional repletion under clinician guidance.13
How safe is LL-37 and what is the FDA status in 2026?
In the human topical trials the two lower doses were well tolerated over a month with no systemic safety signals, while the highest dose produced more local reactions — reflecting LL-37's mammalian-cell cytotoxicity and a narrow therapeutic window.1 The headline safety concern is autoimmunity: LL-37 complexed with self-nucleic acid drives type-I interferon and is a T-cell autoantigen in psoriasis, implicated in cutaneous and systemic lupus and atherosclerosis, so amplifying it in an interferon-prone individual is theoretically capable of provoking or worsening autoimmune skin disease.7 A second concern is tumor promotion: LL-37/hCAP-18 is overexpressed in and promotes ovarian, breast and lung cancers, melanoma and skin squamous-cell carcinoma (it is, however, suppressive in gastric and colon cancer — the effect is tissue-dependent), making exogenous LL-37 a theoretical hazard in anyone with known or suspected hormonally or EGFR-responsive malignancy.910 Concurrent NSAIDs or aspirin could blunt the COX-1-dependent angiogenic effect, and pregnancy and lactation are precautionary contraindications.5
On regulation, LL-37 is not FDA-approved for any indication.20 It had been placed on the restricted 503A Category 2 bulk-substances list, citing limited human safety data, immunogenicity and manufacturing-impurity concerns. Following 2026 policy shifts it is being removed from Category 2 — but it was not moved to compoundable Category 1, and it is specifically queued for a dedicated Pharmacy Compounding Advisory Committee review before the end of February 2027, alongside peptides such as GHK-Cu and Melanotan II.1617 Because any committee recommendation must still pass formal notice-and-comment rulemaking, LL-37 is expected to remain effectively FDA-restricted throughout 2026 — neither approved nor legally compoundable — and is otherwise sold only as a research chemical of unverified purity.18 For athletes, LL-37 is not specifically named on the WADA Prohibited List, but the landscape is in flux and the annual list should be verified.19
Bottom line. LL-37 is a genuinely important innate-immune molecule with elegant mechanisms, but as a therapy the human evidence is narrow: only small, early-phase topical wound-healing RCTs (grade B) support efficacy, in venous leg ulcers, where more is worse. Every other touted use is preclinical (C) or anecdotal (D) and should be read as hyped, not proven. The short half-life, narrow cytotoxic window, immunogenicity, and serious autoimmune and oncologic concerns are real reasons for caution. The most defensible takeaway for a general reader is not to chase injectable research LL-37 but to support endogenous cathelicidin through vitamin-D sufficiency under clinician guidance, and to treat exogenous LL-37 as an investigational topical wound agent, nothing more. Regulatory facts here are current as of June 2026 and should be re-verified against the FDA PCAC calendar.
References
| # | Source | Type |
|---|---|---|
| 1 | Gronberg A, et al. "Treatment with LL-37 is safe and effective in enhancing healing of hard-to-heal venous leg ulcers: a randomized, placebo-controlled clinical trial." Wound Repair Regen 2014. pubmed.ncbi.nlm.nih.gov/25041740 | RCT |
| 2 | Mahlapuu M, et al. "Multicentric, randomized, placebo-controlled phase II trial of LL-37 in hard-to-heal venous leg ulcers." Wound Repair Regen 2021. onlinelibrary.wiley.com/doi/full/10.1111/wrr.12977 | RCT |
| 3 | Efficacy of LL-37 in an MRSA-infected full-thickness wound model in mice. PMC 2021 (PMC8532939). pmc.ncbi.nlm.nih.gov/articles/PMC8532939 | Animal |
| 4 | "Membrane core-specific antimicrobial action of the cathelicidin LL-37." Sci Rep 2016;6:38184. nature.com/articles/srep38184 | In vitro |
| 5 | "LL-37 induces angiogenesis via the FPR2/COX-1-PGE2 pathway." Arterioscler Thromb Vasc Biol (ATVB) 2014. ahajournals.org/doi/10.1161/atvbaha.113.301851 | Animal |
| 6 | "LL-37 as a potential treatment for polymicrobial infected wounds." Front Immunol 2013;4:143. frontiersin.org/articles/10.3389/fimmu.2013.00143 | Review |
| 7 | "The immunomodulatory role of the cathelicidin LL-37 in autoimmune disease and viral infection." Vaccines 2020 (PMC7565865). pmc.ncbi.nlm.nih.gov/articles/PMC7565865 | Review |
| 8 | "LL-37 inhibits LPS/ATP-induced macrophage pyroptosis." PMC 2014 (PMC3894207). ncbi.nlm.nih.gov/pmc/articles/PMC3894207 | In vitro |
| 9 | Coffelt SB, et al. "The pro-inflammatory peptide LL-37 promotes ovarian tumor progression through recruitment of multipotent mesenchymal stromal cells." PNAS 2009. pnas.org/doi/10.1073/pnas.0900244106 | Animal |
| 10 | "The role of cathelicidin LL-37 in cancer development." PMC 2016 (PMC4713713). pmc.ncbi.nlm.nih.gov/articles/PMC4713713 | Review |
| 11 | "Antimicrobial peptides of the cathelicidin family: LL-37 and its modifications." PMC 2025 (PMC12386566). ncbi.nlm.nih.gov/pmc/articles/PMC12386566 | Review |
| 12 | "Cathelicidin antimicrobial peptide (CAMP gene): sequence and biosynthesis." Wikipedia 2025. en.wikipedia.org/wiki/Cathelicidin_antimicrobial_peptide | Review |
| 13 | "Regulation of the CAMP gene encoding LL-37 by vitamin D and HDAC inhibition." PMC 2016 (PMC5025742). pmc.ncbi.nlm.nih.gov/articles/PMC5025742 | In vitro |
| 14 | Cavaco M, et al. "Estimating peptide half-life in serum." Clin Transl Sci 2021. ascpt.onlinelibrary.wiley.com/doi/10.1111/cts.12985 | Review |
| 15 | "Upregulating human cathelicidin LL-37 in COVID-19 inflammation." Front Immunol 2022. frontiersin.org/articles/10.3389/fimmu.2022.880961 | Review |
| 16 | "FDA's Pep(tide) Rally: what compounders and industry need to know" (503A Category 2 / PCAC status). FDA Law Blog, Apr 2026. thefdalawblog.com | Regulatory |
| 17 | FDA — Pharmacy Compounding Advisory Committee meeting calendar (503A bulk-substance review), 2026. fda.gov | Regulatory |
| 18 | Peptide-DB — FDA peptide reclassification tracker, 2026 (secondary). peptide-db.com/guides/fda-peptide-reclassification-2026 | Regulatory |
| 19 | WADA Prohibited List, 2026. wada-ama.org/en/prohibited-list | Regulatory |
| 20 | Superpower — LL-37 clinical guide, 2026 (regulatory snapshot, secondary). superpower.com/guides/ll-37 | Review |
| 21 | RealPeptides — LL-37 half-life and stability summary (secondary, lab-handling). realpeptides.co/whats-half-life-ll-37 | Review |
Frequently Asked
Common questions · evidence-graded answersIs LL-37 proven to work in humans?
Only narrowly. The single indication with human randomized controlled evidence is topical chronic wound healing in hard-to-heal venous leg ulcers, where small, early-phase, placebo-controlled trials showed accelerated closure at low concentrations. PeptideVox grades that wound-healing signal B. Everything else attributed to LL-37 — systemic antimicrobial, anti-biofilm, antiviral, immune, gut or longevity claims — is preclinical (graded C) or purely anecdotal (graded D). So the honest summary is that LL-37 has a promising but early single-indication human signal for topical wound care, and no proven systemic human therapy. A strong mechanism and impressive mouse data should not be read as proof of human benefit.
How does LL-37 work?
LL-37 is a cationic, amphipathic alpha-helix that binds preferentially to the anionic membranes of microbes, inserts into the lipid core and destabilizes the bilayer, killing bacteria, fungi and some enveloped viruses. Beyond direct killing it is a powerful immune modulator with a genuinely double-edged role: it neutralizes bacterial LPS (endotoxin) and can be protective in sepsis models, yet when complexed with self-DNA or self-RNA it activates dendritic cells through TLR9 and TLR7/8 to drive type-I interferon, and it is an established T-cell autoantigen in psoriasis. For wound repair it promotes new blood-vessel formation through the FPR2 receptor, EGFR transactivation and a COX-1-dependent PGE2 pathway. None of these mechanisms equal proven systemic human efficacy.
Is LL-37 legal in 2026?
LL-37 is not an FDA-approved drug for any indication. It had been placed on the restricted 503A Category 2 bulk-substances list, citing limited human safety data, immunogenicity and manufacturing-impurity concerns. Following 2026 policy shifts it is being removed from Category 2 — but it was not moved to the compoundable Category 1 list, and it is specifically queued for a dedicated Pharmacy Compounding Advisory Committee review before the end of February 2027. Because any committee recommendation must still pass formal notice-and-comment rulemaking, LL-37 is expected to remain effectively FDA-restricted throughout 2026, neither approved nor legally compoundable. It is otherwise sold only as a gray-market research chemical of unverified purity.
What are the risks and side effects of LL-37?
In the human topical trials the two lower doses were well tolerated over a month, while the highest concentration produced more local wound-site reactions and no added benefit — a sign of LL-37's mammalian-cell cytotoxicity at higher levels. The headline concern is mechanistic and theoretical: LL-37 complexed with self-DNA drives type-I interferon and acts as an autoantigen, so amplifying it could in principle provoke or worsen interferon-driven autoimmune skin disease such as psoriasis or lupus. There is also a tumor-promotion concern, because LL-37 is overexpressed in and promotes ovarian, breast and lung cancers, melanoma and skin squamous-cell carcinoma. Pregnancy and lactation are precautionary contraindications given the absence of safety data.
Can athletes use LL-37?
LL-37 is not specifically named on the WADA Prohibited List and is not a recognized prohibited substance, so it differs from peptides like BPC-157 that are banned at all times. That said, there is no ergogenic evidence for LL-37 — it is an innate-immune host-defense molecule, not a performance peptide, and it has not been studied for athletic use. Because the peptide regulatory landscape is in flux and prohibited-substance lists are revised annually, any WADA-tested athlete should verify the current annual list before assuming LL-37 is permitted, and should weigh the serious autoimmune and tumor-promotion concerns that apply to everyone.
Is taking vitamin D a better way to raise LL-37 than injecting it?
For most readers, yes, that is the more evidence-aligned approach. The CAMP gene that encodes LL-37 carries a vitamin-D response element in its promoter, so endogenous cathelicidin output is vitamin-D-dependent. Vitamin-D-deficient individuals have a lower baseline cathelicidin tone that nutritional repletion can raise, and vitamin D3 has been studied as a CAMP-gene inducer in some infection contexts. From a functional-medicine, root-cause standpoint, supporting endogenous LL-37 through vitamin-D sufficiency under clinician guidance is better evidenced and far safer than chasing injectable research-grade LL-37, which carries cytotoxicity, immunogenicity and autoimmune or oncologic risks and is not FDA-sanctioned for human use.
PeptideVox is an evidence reference, not medical advice. Nothing here authorizes you to acquire, possess, or self-administer any compound.
Elevated-risk compound. This peptide carries documented or plausible serious adverse effects, minimal human safety surveillance, or unregulated supply. The evidence does not support self-administration. Do not use outside qualified medical or institutional-research oversight.
This content is for informational and educational purposes only · No physician–patient relationship is created · Evidence grades reflect published data as of the stated revision and may change.